Friday, August 10, 2012

pengertian,fungsi, & macam-macam periperal

Macam Macam Peripheral Komputer
Diposkan oleh Admin Label: belajar komputer , registry window xp , seting Internet
Macam Macam Peripheral Komputer silahkan disimak artikelnya berikut ini semoga berkenan dan bermanfaat untuk agan sekalian dalam belajar komputer tentang Macam Macam Peripheral Komputer
Cara Mudah Mendownload Video di | down...
Dalai Lama says "A-Z" about life
GTA San Andreas kode (Cheat)

Peripheral Komputer

Peripheral komputer merupakan peralatan tambahan komputer yang dibutuhkan untuk keperluan – keperluan lain. Misalnya koneksi jaringan, mencetak, atau mengambil gambar. Peripheral tersebut meliputi Printer, Scanner, Modem, Network Card, dan lain sebagainya. Instalasi peripheral meliputi instalasi secara fisik dan instalasi secara software. Instalasi fisik meliputi pemasangan peripheral dengan baik dan benar, dan instalasi software meliputi pengenalan peripheral terhadap sistem operasi yaitu dengan menginstall driver yang dibutuhkan.
1) Printer
Printer merupakan komponen output yang digolongkan sebagai Hard Copy Device. Yaitu merupakan alat yang digunakan untuk mencetak keluaran dari proses yang dilakukan oleh komputer baik tulisan maupun grafik secara langsung dengan menggunakan media kertas ataupun yang lainnya.
Ada tiga jenis printer yang beredar dipasaran.
Printer Dot Matrik merupakan printer yang menggunakan pita sebagai alat percetakannya.
Ink Jet menggunakan tinta.
Laser jet menggunakan serbuk laser.

Printer Dot Matrik
Ink Jet Printer
Laser jet Printer
Menurut konektor printer ada dua macam yaitu melalui konektor Paralel Port dan USB Port.
Langkah – langkah instalasi printer :
- Tancapkan kabel printer pada printer dan konektor parallel port male/konektor USB port pada komputer dengan benar.
- Pastikan catridge printer sudah terpasang dengan benar.
- Hubungkan printer ke jala-jalla listrik
- Dan pastikan ada ativitas dalam printer tersebut (catrigde bergerak).
- Sampai langkah ini instalasi peripheral secar fisik sudah selesai
- Selanjutnya tinggal instalasi untuk software yaitu pemasangan driver.
Pada instalasi driver, biasanya pada sistem operasi Windows XP akan secara otomatis menjalankan file instalasi driver tersebut. Langkah – langkahnya adalah sebagai berikut :
- Masukan CD Driver bawaan printer tersebut, dalam praktek kali ini printer yang akan diinstal adalah printer Canon BJC-2100.
- Setelah CD dimasukan, Windows akan secara otomatis menjalankan file eksekusi dan akan muncul kotak dialog
- Setelah itu tekan tombol Next, untuk konfirmasi bahwa Anda akan menginstall driver tersebut. Dan setelah itu akan muncul kotak dialog.
- Klik tombol Start, untuk memulai proses instalasi dengan memilih option Printer Driver.
- Setelah proses peng-copy-an file selesai, akan muncul kotak dialog seperti gambar di bawah ini.
- Untuk selanjutnya tekan tombol Manual Selection untuk memilih port yang akan digunakan. Dan setelah itu akan muncul kotak dialog
- Setelah pemilihan port selesai, tekan tombol Next dan proses instalasi akan selesai dan printer siap digunakan.
2) Scanner
Scanner adalah suatu alat elektronik yang fungsinya mirip dengan mesin fotokopi, scanner hasilnya ditampilkan pada layar monitor komputer dahulu kemudian baru dapat dirubah dan dimodifikasi sehingga tampilan dan hasilnya menjadi bagus yang kemudian dapat disimpan sebagai file text, dokumen dan gambar.

Scanner berukuran pena dinamakan Quicklink. Pena scanner itu berukuran panjang enam inci dan beratnya sekitar tiga ons.

Pada saat ini banyak sekali scanner yang beredar di dunia dengan berbagai merk pula, Di antaranya scanner keluaran dari Canon, Hewlett Packard ( HP ), EPSON, UMAX dan masih banyak lagi. Perbedaan tiap scanner dari berbagai merk terletak pada pemakaian teknologi dan resolusinya.
Langkah-langkah instalasi driver scaner:
- Masukan CD Driver Scaner tersebut, dalam hal ini Scaner yang akan dicontohkan adalah Scanner CanoScan 3200/3200F.
- Langkah selanjutnya memilih bahasa yang akan digunakan dalam proses instalasi.
- Selanjutnya adalah memilih software yang diinstall dalam hal ini software untuk mengambil gambar yang diambil oleh Scaner.
- Setelah muncul kotak dialog seperti gambar di atas dan pilih Install the Software, maka akan muncul kotak dialog
-Pada kotak dialog tersebut, pengguna dapat memilih software yang akan diinstall dan software yang tidak akan diinstall. Kemudian klik tombol Start Instalation.
- Setelah itu tinggal mengikuti konfirmasi yang ditampilkan. Dan setelah selesai proses instalasi, Scaner siap digunakan.
3) Modem
Modem merupakan salah satu perangkat komputer untuk perantara komputer dengan saluran telphone agar data berhubungan Internet Service Provider (ISP).
Modem ada dua macam, yaitu modem internal dan modem external. Modem internal yaitu modem yang pasang di dalam motherboard dalam bentuk kartu. Teknik pemasangannya sama seperti kartu – kartu lain pada umumnya. Sedangkan modem external adalah yang dapat dipasang dan dilepas sewaktu – waktu.

Modem External Modem Internal

Sebelum mengaktifkan jaringan internet di rumah kita, sebaiknya kita harus mengetahui dulu bagaimana cara menginstal modem. Modem merupakan perangkat wajib yang harus ada pada komputer rumah kalau ingin mengaktifkan internet.
Cara menginstall modem :
1 Pastikan bahwa modem anda telah terpasang dengan baik dan terhubung ke komputer dengan keadaan menyala.
2. Klik ganda My Computer > klik ganda Control Panel > klik ganda Modems, atau cara lain klik Start > Settings > Control Panel > klik ganda Modems,
3. Pada kotak dialog Install New Modem klik Next, windows akan mendeteksi modem anda secara otomatis.
4. Jika windows telah berhasil mendetect modem klik Next > Finish
5. Jika muncul pesan windows did not find any modem attach to your modem, klik Next
6. Kemudian pilih jenis modem yang sesuai dengan modem anda.
7. Klik Next, kemudian pilih port yang akan saudara pakai biasanya COM 1
8. Klik Next > Finish > OK
Konfigurasi untuk Telkomnet instan
TELKOMNet INSTAN adalah layanan Internet Dial Up (dengan menggunakan line telepon) yang paling mudah dalam hal setting. Selain itu layanan ini memiliki kapasitas bandwidth ke luar negeri yang besar dari beberapa link. Untuk dial ke TelkomNet Instan hanya diperlukan tiga langkah saja, yakni:
1. Setting Modem
2. Setting Koneksi ke TelkomNet Instan
3. Dial ke TelkomNet Instan
• Nomor dial : 0809 8 9999
• User id : telkomnet@instan
• Password : telkom
• DNS : Sebaiknya dikosongkan , boleh diisi : dan
• Proxy : Sebaiknya dikosongkan, boleh menggunakan
(diambil dari
4) Webcam
Webcam atau web camera adalah kamera digital yang terhubung dengan computer dan terhubung dengan halaman web .Dengan menggunakan teknologi ini, maka kamera yang ada pada komputer akan memberikan informasinya, yaitu berupa gambar yang dimunculkan melalui halaman web.
Pertama, pastikan Anda mengikuti instruksi dari produsen kamera Anda untuk memastikan kamera Anda diinstal dengan benar.
Ini termasuk memasukkan CD instalasi kamera, dipandu melalui beberapa langkah instalasi, dan me-restart komputer Anda. Menghubungkan kabel USB kamera di saat yang tidak tepat selama prosedur instalasi perangkat lunak kamera dapat menyebabkan berbagai masalah.
Untuk menginstal ulang webcam Anda:
Batalkan instalasi kamera yang ada. Klik “Start,” “Settings,” “Control Panel,” dan “Add/Remove Programs”. Dari daftar, pilih perangkat lunak webcam Anda dan klik Remove.
Cabut kabel USB kamera dari komputer.
Hidupkan kembali komputer Anda.
Masukkan CD instalasi/pengaturan kamera Anda.
Ikuti instruksi yang diuraikan oleh program pengaturan kamera, dan sambungkan kamera Anda hanya saat diminta. Biasanya dilakukan setelah me-restart komputer Anda.
5) Speaker
Suatu alat yang mengkonversi isyarat audio analog ke dalam getaran udara yang sejenisnya dalam rangka membuat bunyi;serasi dapat didengar.

Cara Menginstal :

-klik kanan my computer pilih propertise
- lalu, klik hardware pilih device manager
- klik sound, video and games controller
-masukkan CD bawaan Kmptr lalu
Klik kanan tanda tanya / seru tsb, pilih update driver.
5) Network Card
Kartu jaringan ( network interface card disingkat NIC atau juga network card) adalah sebuah kartu yang berfungsi sebagai jembatan dari komputer ke sebuahjaringan komputer. Jenis NIC yang beredar, terbagi menjadi dua jenis, yakni NIC yang bersifat fisik, dan NIC yang bersifat logis. Contoh NIC yang bersifat fisik adalah NIC Ethernet, Token Ring, dan lainnya; sementara NIC yang bersifat logis adalah loopback adapter dan Dial-up Adapter. Disebut juga sebagai Network Adapter. Setiap jenis NIC diberi nomor alamat yang disebut sebagai MAC Addres, yang dapat bersifat statis atau dapat diubah oleh pengguna.

Wireless Network Card PCI Network Card
Prosedur yang dilakukan untuk menginstall dan mengkonfigurasi kartu jaringan:
Control Panel, double-klik icon Network.
Pilih tab Configuration, klik Add.
Setelah itu muncul kotak dialog Select Network Component Type, klik Adapter, lalu klik Add.
Pilih jenis adapter yang digunakan, setelah itu klik OK.
Klik OK untuk menutup kotak dialog Network Properties.
Setelah meng-copy file yang dibutuhkan untuk menginstall kartu jaringan, Windows 98 akan me-restart komputer.
Setelah komputer di-restart, konfigurasi kartu jaringan dari Control Panel dan double-klik icon Network.
Pilih Adapter, lalu klik Properties.
Menginstall Protokol Jaringan
Untuk dapat “berkomunikasi” antara dua buah komputer atau lebih dalam jaringan komputer, gunakan protokol yang sering (umum) digunakan.
Prosedur yang dilakukan untuk menginstall protokol jaringan:
Buka Control Panel dan double-klik ikon Network.
Dalam tab Configurasi klik Add.
Pada kotak dialog Select Network Component Type, pilih Protocol dan klik Add.
Pilih Manufacturer dan Network Protocol dan klik OK.
Windows98 menyediakan multiple-protokol di dalam satu komputer meliputi
NetBIOS Enhanced User Interface (NetBEUI)? protokol sederhana yang dapat digunakan untuk hubungan LAN sederhana dengan hanya satu subnet yang bekerja berdasarkan penyiaran (broadcast base).
Internetwork Packet Exchange/Sequenced Packet Exchange (IPX/SPX)? protokol yang digunakan dalam lingkungan Novell NetWare. IPX/SPX tidak direkomendasikan untuk penggunan non-NetWare, karena IPX/SPX tidak universal seperti TCP/IP.
Microsoft Data-link Control(DLC)? dibuat oleh IBM digunakan untuk IBM mainframe dan AS/400.
Transmission Control Protocol/Internet Protokol(TCP/IP)? protokol standar yang umum digunakan.
Fast Infrared Protocol ? digunakan secara wireless (tanpa kabel), protokol yang mendukung penggunaan hubungan jarak dekat dengan menggunakan infrared. IrDA (infrared Data Association) digunakan antara lain oleh komputer, kamera, printer, dan personal digital assistant (PDA) untuk saling berkomunikasi.
Asynchronous Transfer Mode (ATM)? teknologi jaringan high-speed yang mampu mengirim data, suara, dan video secara real-time.
Mengkonfigurasi TCP/IP
Implementasi TCP/IP pada Windows98 meliputi protokol standar TCP/IP, kompatible dengan TCP/IP berbasis jaringan.
Protokol standar TCP/IP termasuk:
1. Internet Protocol,
2. Transmission Control Protocol (TCP),
3. Internet Control Message Protocol (ICMP),
4. Address Resolusion Protocol (ARP),
5. User Datagram Protocol (UDP).
TCP/IP harus dikonfigurasikan sebelum dahulu agar bisa “berkomunikasi” di dalam jaringan komputer. Setiap kartu jaringan komputer yang telah diinstall memerlukan IP address dan subnet mask. IP address harus unik (berbeda dengan komputer lain), subnet mask digunakan untuk membedakan network ID dari host ID.
Memberikan IP Address
IP address dan subnet mask dapat diberikan secara otomatis menggunakan Dynamic Host Configuration Protocol (DHCP) atau disi secara manual.
Prosedur yang dilakukan untuk mengisikan IP address:
1. Buka Control Panel dan double-klik icon Network.
2. Di dalam tab Configuration, klik TCP/IP yang ada dalam daftar untuk kartu jaringan yang telah diinstall.
3. Klik Properties.
4. Di dalam tab IP Address, terdapat 2 pilihan:
Obtain an IP address automatically
IP address akan diperoleh melalui fasilitas DHCP. DHCP berfungsi untuk memberikan IP address secara otomatis pada komputer yang menggunakan protokol TCP/IP. DHCP bekerja dengan relasi client-server, dimana DHCP server menyediakan suatu kelompok IP address yang dapat diberikan pada DHCP client. Dalam memberikan IP address ini, DHCP hanya meminjamkan IP address tersebut. Jadi pemberian IP address ini berlangsung secara dinamis.
Specify an IP address
IP address dan subnet mask diisi secara manual.
Jika menggunakan IP address statik, pastikan bahwa ip address tersebut akurat. Jika memasukan alamat IP yang tidak benar, Komputer tidak bisa berkomunikasi dalam jaringan. juga pastikan ip address belum dipakai oleh komputer lain pada jaringan karena akan menimbulkan konflik.
5. Klik OK.
6. Jika diperlukan masuk kembali ke dalam kotak dialog TCP/IP Properties, klik tab Gateway, masukkan nomor alamat server.
7. Klik OK.
8. Jika diperlukan untuk mengaktifkan Windows Internet Naming Service (WINS) server, kembali ke dalam kotak dialog TCP/IP Properties, klik tab WINS Configuration, dan klik Enable WINS Resolution serta masukan nomor alamat server.
9. Jika diperlukan untuk mengaktifkan domain name system (DNS), kembali ke dalam kotak dialog TCP/IP Properties, klik tab DNS Configuration, klik Enable DNS, masukkan nomor alamat server.
10. Klik OK.
fungsi peripheral

Merupakan bagian utama dari strukutur komputer yang mengikat semua komponen menjadi satu. Fungsi utamanya yaitu untuk menyimpan chip microprosessor komputer dan menghubungkannya komponen komponen lain melalui slot atau port. Pada motherboard terdapat Bus Bus yang menghubungkan satu bagian motherboard ke bagian lainnya. Kecepatan bus biasanya merujuk pada FSB (Front Side Bus) yang menghubungkan CPU ke Northbridge. Pada motherboard terdapat :

1.Socket untuk microprosessor menentukan jenis Central Processing Unit (CPU) yang dipakai. Socket ini digunakan untuk menempatkan otak dari komputer yaitu Processor

2.Processor merupakan inti dari semua kinerja sebuah sistem di komputer dan peranannya sangatlah vital.

3.Chipset ,yaitu bagian logic system dari motherboard dan biasanya terdiri dari dua bagian : Northbridge dan Southbridge. Chipset merupakan potongan – potongan kecil silikon yang digunakan untuk menyimpan informasi dan instruksi komputer. Merupakan bagian integral pada motherboard dan tidak dapat dicabut atau di upgrade. Pada tiap komponen komputer memiliki paling tidak terdapat satu chipset. Chipset pada motherboard mengontrol masukan dan keluaran (Input Output) yang mendasar dari komputer. Northbridge menghubungkan processor ke memory system dan bus AGP dan PCI (menghubungakan langsung prosessor melalui FSB/Front Side Bus), Southbridge mengontrol bus IDE,USB,PnP, PCI to ISA, keyboard dan mouse, power management dan lain - lain. Southbridge lebih lambat dari northbridge dan informasi dari CPU harus melewati Northbridge sebelum sampai ke Southbridge Seluruh komponen komputer berkomunikasi dengan CPU melalui Chipset.

4.Chip BIOS (Basic Input/Output System), untuk mengendalikan kebanyakan fungsi dasar pada komputer dan melakukan self test setiap kali menyalakan komputer yang gunanya untuk mempersiapkan semua hardware yang kemudian menjalankan Operating System ,sehingga aplikasi yang terdapat dalam sistem dapat mengontrol kerja komputer. Bios sendiri tersimpan dlam Flash RAM dengan kapasitas sekitar 2-4 MB.

5.ALU (Arithmetic and Logical Unit) yaitu bagian dari CPU yang berguna untuk memperoses data secara logika dan juga data yang memerlukan perhitungan. ALU terdiri dari register-register untuk menyimpan informasi.

6.Chip Real Time Clock yang beroperasi dengan baterai untuk menjaga setting dasar dan waktu sistem.

7.Chip VGA (Video Graphic Accelarator), yaitu untuk mengatur grafis dan rendering grafis 3D dan output dari gambar ke monitor. Chip ini hanya ada pada motherboard yang memiliki VGA on board saja.

8.Chip Soundcard, fungsinya untuk mengontrol output suara yang dihasilkan dari komputer ke speaker atau line in ke komputer untuk diproses.

9.Chip Networking/LAN (Local Area Networking),dimiliki pada komputer model terbaru yang berguna apabila digunakan dalam sistem workstation/jaringan.

10.Chip Wireless LAN yang mengusung koneksi networking tanpa kabel.

11.Chip Raid Controller fungsinya mengontrol penggunaan RAID pada komputer. RAID sendiri adalah gabungan 2 buah harddisk dengan kecepatan tinggi yang aman dan simultan.

12.Chipset Khusus biasanya chip ini sengaja dimasukkan oleh vendor/produsen motherboard yang fungsinya untuk pengendalian sistem dan memacu kinerja komputer diatas rata-rata/normal, istilah ini sering disebut dengan Overclocking. Overclock sendiri yaitu mengubah frekuensi standar Processor dan komponen lainnya (memory dan VGA card) menjadi lebih tinggi untuk mendapatkan speed tinggi.

13.Chip RAMDAC (Random Access Memory Digital to Analog Converter) merupakan chip pengontrol VGA yang mengatur color pallete dan convert data dari memory ke sinyal analog di monitor.
            Berbentukmiripmesinketik yang berisihuruf, angka, simbol-simbolkhusussertatombol-tombolfungsi. Gunanyauntukmemberiperintahkepadakomputerdengancaramenuliskannyaataumenekankombinasibeberapatombol. Saatinisejumlahperusahaanseperti Microsoft dan Logitech sudahmembuat keyboard tanpakabel (wireless) yang menggunakanpancaran infrared.
            Alat yang miriptikusdanterdiridariduaatautigatombol, berfungsiuntukmengendalikankursor/pointer dilayar monitor dengancaramenggerakkannyamaju, mundurataukesamping. Didalamnyaterdapat bola karet yang akanmenggerakkanroda-rodakecil, yang akanmengaturgerakankursor/pointer. Mouse generasiterbarubiasanyadilengkapiscrolling buttonuntukmemudahkanbergerakturun/naikdilayar monitor.Mouse jugabisadigunakanuntukmemainkan game.Kini mouse wireless jugatelahdiproduksi.
            Miripbolpoinbiasa, hanyaujungnyamemiliki sensor elektromagnetik.Bisadigunakanuntukmenulis, tetapijugamampumembacakode-kodekhusus yang kemudianditerjemahkanolehkomputer.
            Fungsinyasamapersisdengan mouse, hanyatampilannyaberbeda. Pada trackball, bola yang menggerakkankursor/pointer beradadiluardanharusdigerakkanolehjarikitakearah yang kitainginkan.Jikabadan mouse haruskitagerakkanseluruhnyadiatasmeja, badan trackball tetapdiamditempat.Sepertihalnya keyboard dan mouse, trackball wireless jugatelahada di pasaran. Bermain game dengan trackball agaklebihsulitdibandingkan mouse.
            Bentuknyamiriptelevisidanberfungsimenampilkan proses danhasilpekerjaankomputer. Monitor komputerjamanduluhanyahitamputihatau monochrome (terkadangdengantulisanhijauatau orange danlatarbelakanghitam). Sekarang monitor hampirsemuanyaberwarnadanberesolusitinggi, sehinggakualitasgambar yang dihasilkannyajugajauhlebihbagus.
Digunakanuntukmencetakhasil proses komputerkeataskertassehinggabisadibaca. Ada tigajenis printer yang dikenalluasyaitudot-matrix printer, inkjet printer, danlaser printer.
            Samafungsinyadengan printer tetapikhususuntukmencetakgambar.Kertas yang dipergunakanjugalebihbesardarikertasbiasa. Plotter generasipertamaharusdipasangirapido (penakhususuntukmenggambar), namunsekarang plotter jugaterdiridari inkjet dan laser.
            Digunakanuntukmengambilcitracetakan (gambar, foto, tulisan) untukdiolahatauditampilkanmelaluikomputer.Ada duajenis scanner, handy scanner (dipegangdandigerakkandengantangan), danflatbed scanner (serupamesinfotokopi).
            Fungsinyasamadengandisket, ukurannyajugasama 3,5inci – hanyaagaklebihtebal – namunkapasitasnyajauhlebihbesar – 100MB yang kira-kirasamadengan 70 disketberkapasitas 1,44MB. Zip driveinidibuatolehperusahaan Iomega.
            Samafungsinyadengan disk drive yang terpasang di casing, tetapi yang iniberadadiluardandihubungkandengankabel.Umumnyadigunakanuntukkomputer laptop/notebook.
Berfungsiuntukmenjalankan tape dalampenyimpanan/pengambilan data.
            Untukmemasukkandanmerekamsuarasertamendengarkanhasilrekaman yang sudahdisimpandidalamkomputer, ataumendengarkanmusikdansuaradari CD, MP3 atau game.
            Alatberbentuktongkatkecil (biasanyadilengkapibeberapatomboldenganfungsi yang bisadiatur) untukmemudahkanbermain game, misalnyamengendalikanpesawatataumobil. Dapatjugaberfungsisebagai mouse.
            Fungsinyasamadengan joystick hanyabentuknyaberbeda, mirippapankecil yang memilikipegangandandiatasnyabanyakterdapattombol-tombol. Jugabisaberfungsisebagai mouse.
            Kerjanyamiripkamerafotobiasa, hanyasajahasilnyalangsungdisimpandalam format data komputer.Hasil yang diperolehjauhlebihbagusdibandingkanhasilcetakan film negatif.
            Modem external dipasangdiluar casing dandihubungkanmelaluikabel, sedangkan modem internal berbentuk card yang ditancapkanpada mainboard. Modem berfungsimengubahsinyal digital ke analog dansebaliknya, gunamengirim data komputermelaluisalurantelepon. Jikainginmenggunakan internet, modem harustersedia.


Post a Comment